PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_29197-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bHLH
Protein Properties Length: 88aa    MW: 9912.15 Da    PI: 8.5247
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_29197-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH24.55e-0815541554
                     HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
              HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                     +iN+ +++L++llP++ + +s   s    L++++ YIksL
  TRIUR3_29197-P1 15 EINELMSKLQSLLPNSRRRGSSQASTTKLLKETCSYIKSL 54
                     7**************77899999****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.194154IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.9E-91474IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474593.53E-101477IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.7E-51554IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MSSRRSSRGA ISEEEINELM SKLQSLLPNS RRRGSSQAST TKLLKETCSY IKSLHREVDD  60
LSDRLSDLMS TMDHNSAEAE IIRGLLRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3756311e-126AK375631.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3099P09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953911.14e-48PREDICTED: transcription factor ILI5
SwissprotA2X9L81e-44ILI5_ORYSI; Transcription factor ILI5
SwissprotQ6YUX01e-44ILI5_ORYSJ; Transcription factor ILI5
TrEMBLT1NF271e-55T1NF27_TRIUA; Uncharacterized protein
STRINGMLOC_55094.12e-51(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92838145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.16e-19bHLH family protein